PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC032060.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 309aa    MW: 33217.9 Da    PI: 6.6511
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC032060.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.11e-3349103155
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   k+rlrWt++LH+rFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  EcC032060.30  49 KQRLRWTHDLHDRFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 103
                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.07246106IPR017930Myb domain
SuperFamilySSF466892.87E-1747103IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-3248104IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-2649104IPR006447Myb domain, plants
PfamPF002497.8E-951102IPR001005SANT/Myb domain
PfamPF143791.6E-23136182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009301Biological ProcesssnRNA transcription
GO:0009926Biological Processauxin polar transport
GO:0009942Biological Processlongitudinal axis specification
GO:0009945Biological Processradial axis specification
GO:0010014Biological Processmeristem initiation
GO:0010311Biological Processlateral root formation
GO:0015074Biological ProcessDNA integration
GO:0043697Biological Processcell dedifferentiation
GO:0060184Biological Processcell cycle switching
GO:0071365Biological Processcellular response to auxin stimulus
GO:0071368Biological Processcellular response to cytokinin stimulus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0004857Molecular Functionenzyme inhibitor activity
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MYQQKGGASS SLVPGNTMVH GQHLDSGANT MDSIGGGNNH SNNANLTSKQ RLRWTHDLHD  60
RFVDAVAQLG GPDRATPKGV LRVMGVQGLT IYHVKSHLQK YRLAKYLPDS SSDGKKAEKK  120
ESADVLSDMD GSSGGMQITE ALKLQMEVQK RLHEQLEVQR QLQLRIEAQG KYLKKIIEEQ  180
QRLSGALADG SADESGDKGQ EDSKTDPPTP APISESPIQD KSKDCAVAKS LSLDGSLSSH  240
NHEPLTPDSS CNVSSPAESP DGERSAKKPR VTAGASHAEP EIVLHPIFES SLGCSYTNSS  300
FKLPDQGSV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006449962.11e-150hypothetical protein CICLE_v10015893mg
RefseqXP_006467243.11e-150PREDICTED: protein PHR1-LIKE 1 isoform X1
TrEMBLA0A059CF790.0A0A059CF79_EUCGR; Uncharacterized protein
STRINGVIT_00s0475g00040.t011e-147(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-113G2-like family protein